Iright
BRAND / VENDOR: Proteintech

Proteintech, 83506-1-RR, Osteoprotegerin/TNFRSF11B Recombinant monoclonal antibody

CATALOG NUMBER: 83506-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Osteoprotegerin/TNFRSF11B (83506-1-RR) by Proteintech is a Recombinant antibody targeting Osteoprotegerin/TNFRSF11B in WB, IHC, ELISA applications with reactivity to human, rat samples 83506-1-RR targets Osteoprotegerin/TNFRSF11B in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human milk Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Osteoprotegerin (OPG), also known as tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) and osteoclastogenesis inhibitory factor (OCIF), belongs to the tumor necrosis factor (TNF) receptor superfamily. By binding to RANKL, OPG inhibits osteoclastic activity and promotes bone formation. OPG plays a key role in cell survival by inhibiting TRAIL-induced apoptosis. OPG also is involved in vascular biology, fibrosis, immunity, EMT, and the apoptosis of cancer cells (PMID: 35523775). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2139 Product name: Recombinant human TNFRSF11B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC030155 Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCG Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 11b Calculated Molecular Weight: 401 aa, 46 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC030155 Gene Symbol: TNFRSF11B Gene ID (NCBI): 4982 RRID: AB_3671131 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924