Iright
BRAND / VENDOR: Proteintech

Proteintech, 83527-3-RR, SLC35B4 Recombinant monoclonal antibody

CATALOG NUMBER: 83527-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLC35B4 (83527-3-RR) by Proteintech is a Recombinant antibody targeting SLC35B4 in WB, FC (Intra), ELISA applications with reactivity to human samples 83527-3-RR targets SLC35B4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SLC35B4 (solute carrier family 35 member B4), also known as YEA. It is expected to be located in the endoplasmic reticulum membrane, which is ubiquitinated in placenta and brain. SLC35B4 is a glycosyltransferase, which transports nucleotide sugars from the cytoplasm where they are synthesized, to the Golgi apparatus where they are utilized in the synthesis of glycoproteins, glycolipids, and proteoglycans (PMID: 15911612). Belongs to the nucleotide-sugar transporter family. SLC35B subfamily. The molecular weight of SLC35B4 is 37 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22669 Product name: Recombinant human SLC35B4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC008413 Sequence: MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMV Predict reactive species Full Name: solute carrier family 35, member B4 Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC008413 Gene Symbol: SLC35B4 Gene ID (NCBI): 84912 RRID: AB_3671154 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q969S0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924