Iright
BRAND / VENDOR: Proteintech

Proteintech, 83638-3-RR, RCN1 Recombinant monoclonal antibody

CATALOG NUMBER: 83638-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RCN1 (83638-3-RR) by Proteintech is a Recombinant antibody targeting RCN1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83638-3-RR targets RCN1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells, SH-SY5Y cells, HuH-7 cells Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Reticulocalbin-1 (RCN1) belongs to the CREC family. Reticulocalbin‐1, an endoplasmic reticulum protein, plays a crucial role in calcium homeostasis and inhibits ER stress‐induced apoptosis (PMID: 28319095). Its main functions include maintaining intracellular homeostasis and regulating cell proliferation and apoptosis, and it plays an important role in the development of various tumours (PMID: 38057406). RCN1 is expressed aberrantly and at a high level in various tumors, including acute myeloid leukemia (AML) (PMID: 37746742). In multiple cancers, such as glioblastoma, non‐small cell lung cancer, renal cell carcinoma, hepatocellular carcinoma, and oral squamous cell carcinoma, the overexpression of RCN1 has been observed indicating its involvement in tumorigenesis and invasion (PMID: 30172915, PMID: 34722631). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13256 Product name: Recombinant human RCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC010120 Sequence: MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHW Predict reactive species Full Name: reticulocalbin 1, EF-hand calcium binding domain Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 44-46 kDa GenBank Accession Number: BC010120 Gene Symbol: RCN1 Gene ID (NCBI): 5954 RRID: AB_3671250 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15293 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924