Iright
BRAND / VENDOR: Proteintech

Proteintech, 84601-1-RR, EGF Recombinant monoclonal antibody

CATALOG NUMBER: 84601-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EGF (84601-1-RR) by Proteintech is a Recombinant antibody targeting EGF in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 84601-1-RR targets EGF in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Epidermal Growth Factor (EGF) is a type of mitogenic factor that stimulates the proliferation of various cells, including epithelial cells and fibroblasts. It is a small peptide composed of 53 amino acids with a molecular weight of approximately 6,000 Daltons. EGF contains three disulfide bonds, which contribute to its stability under acidic and high-temperature conditions. Human EGF is synthesized as transmembrane precursor proteins (1207 amino acids), which are proteolytically cleaved to generate the 54 amino acid mature EGF. EGF plays a crucial role in regulating cell growth, proliferation, and differentiation. When EGF binds to its receptor (EGFR), it activates intracellular signaling pathways that lead to DNA synthesis and cell proliferation. EGF is naturally present in various tissues and body fluids, including saliva, urine, and milk. It is primarily synthesized in the submandibular glands and duodenum. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1965 Product name: Recombinant Mouse EGF protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 977-1029 aa of NM_010113 Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR Predict reactive species Full Name: epidermal growth factor Calculated Molecular Weight: 133 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: NM_010113 Gene Symbol: Egf Gene ID (NCBI): 13645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01132 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924