Iright
BRAND / VENDOR: Proteintech

Proteintech, 86189-2-RR, FKBP5 Recombinant monoclonal antibody

CATALOG NUMBER: 86189-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FKBP5 (86189-2-RR) by Proteintech is a Recombinant antibody targeting FKBP5 in WB, IF/ICC, ELISA applications with reactivity to human samples 86189-2-RR targets FKBP5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells, SH-SY5Y cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5337 Product name: Recombinant human FKBP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-375 aa of BC042605 Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE Predict reactive species Full Name: FK506 binding protein 5 Calculated Molecular Weight: 457 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC042605 Gene Symbol: FKBP5 Gene ID (NCBI): 2289 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924