Iright
BRAND / VENDOR: Proteintech

Proteintech, 98156-1-RR, Anti-Human CD209 Rabbit Recombinant Antibody

CATALOG NUMBER: 98156-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD209 (98156-1-RR) by Proteintech is a Recombinant antibody targeting CD209 in FC applications with reactivity to human samples 98156-1-RR targets CD209 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human monocyte-derived immature dendritic cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD209 (DC-SIGN, CLEC4L) is a C-type lectin receptor that is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens, including bacteria, viruses, and parasites. CD209 is preferentially expressed on dendritic cells (DCs). It mediates transient adhesion of DCs with T cells. It has been reported that CD209 plays a role in capture and transmission of HIV from DC to T cells (PMID: 10721995). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0062 Product name: Recombinant Human CD209 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 59-404 aa of BC110615 Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA Predict reactive species Full Name: CD209 molecule Calculated Molecular Weight: 404 aa, 45.7 kDa GenBank Accession Number: BC110615 Gene Symbol: CD209 Gene ID (NCBI): 30835 RRID: AB_3672299 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NNX6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924