Iright
BRAND / VENDOR: Proteintech

Proteintech, 98360-2-RR, Anti-Mouse IL-4 Rabbit Recombinant Antibody

CATALOG NUMBER: 98360-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-4 (98360-2-RR) by Proteintech is a Recombinant antibody targeting IL-4 in FC (Intra) applications with reactivity to mouse samples 98360-2-RR targets IL-4 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated C57BL/6 Th2-polarized splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3750 Product name: Recombinant Mouse IL-4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC027514 Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Predict reactive species Full Name: interleukin 4 GenBank Accession Number: BC027514 Gene Symbol: IL-4 Gene ID (NCBI): 16189 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07750 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924