Iright
BRAND / VENDOR: Proteintech

Proteintech, 98493-3-RR, Anti-Human CD55 Rabbit Recombinant Antibody

CATALOG NUMBER: 98493-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD55 (98493-3-RR) by Proteintech is a Recombinant antibody targeting CD55 in FC applications with reactivity to human samples 98493-3-RR targets CD55 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human blood cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD55, also known as DAF, is a glycosylphosphatidylinositol (GPI)-anchored surface glycoprotein that is widely distributed on blood, stroma, epithelial, and endothelial cells (PMID: 7517044; 29503741). It can also exist as a soluble form in plasma, urine, saliva, tears, and synovial fluids (PMID: 29503741). CD55 is a complement regulatory protein (PMID: 2469439; 7517044). It inhibits formation of the C3 convertases through binding to C3b and C4b. It also binds the alternate pathway convertase C3bBb, the classical pathway convertase and C4b2a to accelerate their decay (PMID: 17289551). CD55 also serves as a receptor for coxsackieviruses B1, B3, and B5 and several enteroviruses (PMID: 7538177; 7517044). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4246 Product name: Recombinant Human CD55 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 35-353 aa of BC001288 Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS Predict reactive species Full Name: CD55 molecule, decay accelerating factor for complement (Cromer blood group) Calculated Molecular Weight: 41 kDa GenBank Accession Number: BC001288 Gene Symbol: CD55 Gene ID (NCBI): 1604 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08174 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924