Proteintech, 98516-2-RR, Anti-Mouse JAM-A/CD321 Rabbit Recombinant Antibody

Size: 100ug The JAM-A/CD321 (98516-2-RR) by Proteintech is a Recombinant antibody targeting JAM-A/CD321 in FC applications with reactivity to mouse samples 98516-2-RR targets JAM-A/CD321 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse peripheral blood platelets Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Junctional adhesion molecule A (JAM-A), also known as CD321 or F11 receptor (F11R), is a transmembrane protein that belongs to the immunoglobulin superfamily of cell adhesion molecules. JAM-A is present in epithelial cells, endothelial cells, leukocytes, and blood platelets. JAM-A participates in regulating various biological processes, as diverse as paracellular permeability, tight junction formation and maintenance, leukocyte transendothelial migration, epithelial-to-mesenchymal transition, angiogenesis, reovirus binding, and platelet activation. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3117 Product name: Recombinant Mouse JAM-A/Junctional Adhesion Molecule A protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-238 aa of NM_172647.2 Sequence: KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG Predict reactive species Full Name: F11 receptor Calculated Molecular Weight: 32 kDa GenBank Accession Number: NM_172647.2 Gene Symbol: F11r Gene ID (NCBI): 16456 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88792 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.