Iright
BRAND / VENDOR: Abcam

Abcam, ab8985, Anti-Integrin alpha 3a antibody [29A3]

CATALOG NUMBER: ab8985
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description

Size: 100µg
Mouse Monoclonal Integrin alpha 3 antibody. Suitable for IHC-Fr and reacts with Human samples. Cited in 2 publications. Immunogen corresponding to Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin.
Key facts
Host species:Mouse,
Clonality:Monoclonal,
Clone number:29A3,
Isotype:IgG1,
Light chain type:kappa,
Carrier free:No,
Reacts with:Human,
Applications:IHC-FrSee reactivity dataSee the reactivity data table below for information on validated species and application combinations.,
Immunogen:Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin. The exact immunogen used to generate this antibody is proprietary information.P26006,
Epitope:Cytoplasmic domain of a3A Integrin. Phospho-epitope.,
Specificity:29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Product details:
Background
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
Source
29A3 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Formulation:
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.

Properties and Storage Information:
Form-Liquid, Purification technique-Affinity purification Protein G, Storage buffer-Preservative: 0.09% Sodium azideConstituents: PBS, Shipped at conditions-Blue Ice, Appropriate short-term storage duration-1-2 weeks, Appropriate short-term storage conditions-+4°C, Appropriate long-term storage conditions--20°C, Aliquoting information-Upon delivery aliquot, Storage information-Avoid freeze / thaw cycle

Supplementary Information:
This supplementary information is collated from multiple sources and compiled automatically.
Integrin alpha 3a also known as CD49c is a transmembrane protein that forms part of the integrin family. This protein with a molecular weight of approximately 116 kDa functions mainly as a receptor facilitating cell-cell and cell-extracellular matrix interactions. Integrin alpha 3a predominantly localizes on the surface of epithelial and certain mesenchymal cells. Its expression helps mediate communication and structural integrity within various tissues influencing processes such as cell adhesion and migration.
Biological function summary
Integrin alpha 3a plays an important role in cellular signaling related to tissue development and repair. By forming a heterodimer with beta subunits particularly beta 1 integrin it participates in complex cellular processes. This heterodimerization allows integrin alpha 3a to bind specifically to types of laminins and collagens key components in basement membranes. Through these interactions it can influence cellular proliferation and differentiation which are critical in maintaining tissue architecture and regulating developmental pathways.
Pathways
Integrin alpha 3a engages in the PI3K/Akt signaling and MAPK/ERK pathways both of which are significant in promoting cell survival and proliferation. It interacts closely with proteins such as fibronectin and laminin helping to relay signals that affect cytoskeletal dynamics and cell motility. The activity of integrin alpha 3a within these signaling cascades highlights its contribution to anchoring cells to their extracellular matrix influencing their response to external mechanical and chemical cues.
Integrin alpha 3a has links to conditions such as renal fibrosis and certain cancers including breast carcinoma. Its overexpression or dysfunction can disrupt normal cell adhesion and migration contributing to tumor progression and metastatic potential. Moreover it interacts with proteins like matrix metalloproteinases (MMPs) in these contexts facilitating degradation of extracellular matrix which promotes invasive behavior in cancerous cells. Research continues to explore how modulating integrin alpha 3a activity may provide therapeutic insights into these disorders.


Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924