Proteintech, 10055-1-AP, SNAPIN Polyclonal antibody

Size: 20ul / 150ul The SNAPIN (10055-1-AP) by Proteintech is a Polyclonal antibody targeting SNAPIN in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10055-1-AP targets SNAPIN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HEK-293 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human testis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0101 Product name: Recombinant human SNAPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC000761 Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK Predict reactive species Full Name: SNAP-associated protein Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15-18 kDa GenBank Accession Number: BC000761 Gene Symbol: SNAPIN Gene ID (NCBI): 23557 RRID: AB_2192656 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95295 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.