Proteintech, 10060-1-AP, FKBPL Polyclonal antibody

Size: 20ul / 150ul The FKBPL (10060-1-AP) by Proteintech is a Polyclonal antibody targeting FKBPL in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human samples 10060-1-AP targets FKBPL in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human brain tissue, human testis tissue, Jurkat cells, MCF-7 cells, T-47D cells, MDA-MB-453s cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human breast cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193). It can be detected the band between 38 kDa and 48 kDa by western blot. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0112 Product name: Recombinant human FKBPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-237 aa of BC004168 Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL Predict reactive species Full Name: FK506 binding protein like Calculated Molecular Weight: 349 aa, 38 kDa Observed Molecular Weight: 42-48 kDa GenBank Accession Number: BC004168 Gene Symbol: FKBPL Gene ID (NCBI): 63943 RRID: AB_2262677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.