Iright
BRAND / VENDOR: Proteintech

Proteintech, 10085-1-AP, PAFAH2 Polyclonal antibody

CATALOG NUMBER: 10085-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PAFAH2 (10085-1-AP) by Proteintech is a Polyclonal antibody targeting PAFAH2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10085-1-AP targets PAFAH2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The family of platelet-activating factor-acetylhydrolase (PAF-AH) consists of enzymes which catalyze the hydrolysis of acetyl ester at the sn-2 position of PAF(Platelet-activating factor). The intracellular type II PAF-AH is a single polypeptide about a 40 kd distributed in both the cytosol and membranes of many kinds of cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0124 Product name: Recombinant human PAFAH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-392 aa of BC001158 Sequence: WIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL Predict reactive species Full Name: platelet-activating factor acetylhydrolase 2, 40kDa Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 44-46 kDa GenBank Accession Number: BC001158 Gene Symbol: PAFAH2 Gene ID (NCBI): 5051 RRID: AB_2160055 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924