Proteintech, 10086-1-AP, ACVR1B Polyclonal antibody

Size: 20ul / 150ul The ACVR1B (10086-1-AP) by Proteintech is a Polyclonal antibody targeting ACVR1B in WB, ELISA applications with reactivity to human samples 10086-1-AP targets ACVR1B in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0129 Product name: Recombinant human ACVR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-448 aa of BC000254 Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC Predict reactive species Full Name: activin A receptor, type IB Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC000254 Gene Symbol: ACVR1B Gene ID (NCBI): 91 RRID: AB_2877723 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.