Proteintech, 10090-2-AP, ARL2BP Polyclonal antibody

Size: 20ul / 150ul The ARL2BP (10090-2-AP) by Proteintech is a Polyclonal antibody targeting ARL2BP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10090-2-AP targets ARL2BP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, Calu-1 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ARF-like proteins (ARLs) belong to a group of incompletely characterized members in the ARF family of RAS-related GTPases. A 19-kDa protein (BART, Binder of Arl Two) was identified to bind specifically to ARL2.GDP with high affinity but not with ARL2.GDP. In human, the 489-base pair BART open reading frame encodes a novel 163-amino acid protein with a predicted molecular mass of 18,822 Da. Data from Northern and Western analyses indicated BART is expressed in many tissues. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0138 Product name: Recombinant human ARL2BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC003087 Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH Predict reactive species Full Name: ADP-ribosylation factor-like 2 binding protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19-21 kDa GenBank Accession Number: BC003087 Gene Symbol: ARL2BP Gene ID (NCBI): 23568 RRID: AB_2058518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2Y0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.