Iright
BRAND / VENDOR: Proteintech

Proteintech, 10095-2-AP, EEF1B2 Polyclonal antibody

CATALOG NUMBER: 10095-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EEF1B2 (10095-2-AP) by Proteintech is a Polyclonal antibody targeting EEF1B2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10095-2-AP targets EEF1B2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, RAW264.7, Jurkat cells, HEK-293 cells, HeLa cells, SKOV-3 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon tissue, human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information In eukaryotes, the translation elongation factor eEF1A responsible for transporting amino-acylated tRNA to the ribosome forms a higher-order complex, eEF1H, with its guanine-nucleotide-exchange factor eEF1B. eEF1B consists of three subunits: eEF1B alpha, eEF1B beta and eEF1B gamma. The eEF1B2 possess the nucleotide-exchange activity. Although several models on the basis of in vitro experiments have been proposed for the macromolecular organization of the eEF1H complex, these models differ in various aspects. The human eukaryote elongation factor 1 beta 2 (eEF1B2) migrated as a 30-34 kDa protein in SDS-PAGE. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human EEF1B2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0135 Product name: Recombinant human EEF1B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-223 aa of BC000211 Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFN Predict reactive species Full Name: eukaryotic translation elongation factor 1 beta 2 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC000211 Gene Symbol: EEF1B2 Gene ID (NCBI): 1933 RRID: AB_2096987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924