Iright
BRAND / VENDOR: Proteintech

Proteintech, 10099-1-AP, SIRT3 Polyclonal antibody

CATALOG NUMBER: 10099-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SIRT3 (10099-1-AP) by Proteintech is a Polyclonal antibody targeting SIRT3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10099-1-AP targets SIRT3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse heart tissue, human spleen tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat heart tissue, HEK-293 cells, HepG2 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HT-29 cells Positive IHC detected in: human stomach tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Sirtuins are NAD+-dependent histone/protein deacetylases (HDAC) and SIRT3 is the only sirtuin whose increased expression has been shown to correlate with an extended life span in humans. It is localized in the mitochondrial matrix, where it regulates the acetylation levels of metabolic enzymes, including acetyl coenzyme A synthetase 2. SIRT3 is stress-responsive and its increased expression protects myocytes from genotoxic and oxidative stress-mediated cell death. full-length hSIRT3 (44 kDa) is an inert protein and that it is activated inside the mitochondria following deletion of 142 amino acids of the N-terminal segment. This processed form of SIRT3 is approximately 28 kDa and possesses deacetylase activity. The full SIRT3 is a 44 kDa protein and is processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, bovine, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0148 Product name: Recombinant human SIRT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 202-399 aa of BC001042 Sequence: GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC001042 Gene Symbol: SIRT3 Gene ID (NCBI): 23410 RRID: AB_2239240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NTG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924