Iright
BRAND / VENDOR: Proteintech

Proteintech, 10101-2-AP, PITRM1 Polyclonal antibody

CATALOG NUMBER: 10101-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PITRM1 (10101-2-AP) by Proteintech is a Polyclonal antibody targeting PITRM1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10101-2-AP targets PITRM1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, A549 cells, mouse testis tissue Positive IP detected in: A549 cells Positive IHC detected in: human breast cancer tissue, human osteosarcoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PITRM1 (Presequence protease, mitochondrial) is a ATP-independent protease that degrades mitochondrial transit peptides after their cleavage.It is specific for peptides in the range of 10 to 65 residues.and able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease.It shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference(PMID:16849325).This protein has a calculated molecular mass of 117kD and it is expressed widely.This antibody is specific to PITRM1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0150 Product name: Recombinant human PITRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-508 aa of BC001150 Sequence: NGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGT Predict reactive species Full Name: pitrilysin metallopeptidase 1 Calculated Molecular Weight: 60 kDa, 117 kDa Observed Molecular Weight: 110-117 kDa GenBank Accession Number: BC001150 Gene Symbol: PITRM1 Gene ID (NCBI): 10531 RRID: AB_2165145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924