Iright
BRAND / VENDOR: Proteintech

Proteintech, 10113-2-AP, LDOC1 Polyclonal antibody

CATALOG NUMBER: 10113-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LDOC1 (10113-2-AP) by Proteintech is a Polyclonal antibody targeting LDOC1 in WB, ELISA applications with reactivity to human, mouse samples 10113-2-AP targets LDOC1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information LDOC1 contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. LDOC1 localizes to the nucleus and is down-regulated in some cancer cell lines. LDOC1 regulates the transcriptional response mediated by the nuclear factor B (NF-kappa B). The gene encoding LDOC1 protein has been proposed as a tumor suppressor gene which may have an important role in the development and/or progression of some cancers. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0158 Product name: Recombinant human LDOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC003104 Sequence: MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY Predict reactive species Full Name: leucine zipper, down-regulated in cancer 1 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa, 25 kDa GenBank Accession Number: BC003104 Gene Symbol: LDOC1 Gene ID (NCBI): 23641 RRID: AB_2135421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924