Iright
BRAND / VENDOR: Proteintech

Proteintech, 10115-1-AP, WDR77 Polyclonal antibody

CATALOG NUMBER: 10115-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WDR77 (10115-1-AP) by Proteintech is a Polyclonal antibody targeting WDR77 in WB, IHC, ELISA applications with reactivity to human samples 10115-1-AP targets WDR77 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WDR77, other named p44, MEP-50, is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. Normally, WDR77 locates in the nucleus, such as in prostate epithelial cells. However, it localized to the cytoplasm in prostatic intraepithelial neoplasia and prostate cancer cells. Nuclear WDR77 mediates the growth inhibition and differentiation. WDR may involve in the biogenesis of small nuclear ribonucleoprotein particles. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0147 Product name: Recombinant human WDR77 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-342 aa of BC001679 Sequence: RGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE Predict reactive species Full Name: WD repeat domain 77 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC001679 Gene Symbol: WDR77 Gene ID (NCBI): 79084 RRID: AB_2215725 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924