Proteintech, 10119-1-AP, CORO2A Polyclonal antibody

Size: 20ul / 150ul The CORO2A (10119-1-AP) by Proteintech is a Polyclonal antibody targeting CORO2A in WB, IHC, ELISA applications with reactivity to human, mouse samples 10119-1-AP targets CORO2A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells, Raji cells Positive IHC detected in: human skin cancer tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 10119-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0164 Product name: Recombinant human CORO2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 293-523 aa of BC000010 Sequence: GNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSE Predict reactive species Full Name: coronin, actin binding protein, 2A Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000010 Gene Symbol: CORO2A Gene ID (NCBI): 7464 RRID: AB_2877724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92828 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.