Iright
BRAND / VENDOR: Proteintech

Proteintech, 10124-2-AP, VGLL1 Polyclonal antibody

CATALOG NUMBER: 10124-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VGLL1 (10124-2-AP) by Proteintech is a Polyclonal antibody targeting VGLL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10124-2-AP targets VGLL1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human brain tissue, rat brain tissue, PC-3 cells, mouse brain tissue, mouse spleen tissue, rat spleen tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information VGLL1 is a specific coactivator for the mammalian TEFs. It can bind proteins of the TEA domain family of transcription factors. Vgll1-TEFs complex upregulates the expression of IGFBP-5, a proliferation-promoting gene, and facilitates anchorage-independent cell proliferation. The calculated molecular weight of VGLL1 is 29 kDa, and the observed molecular weight is 26-29 kDa(PMID:31816819,33087697). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0169 Product name: Recombinant human VGLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-255 aa of BC000045 Sequence: SSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYL Predict reactive species Full Name: vestigial like 1 (Drosophila) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 26-29 kDa GenBank Accession Number: BC000045 Gene Symbol: VGLL1 Gene ID (NCBI): 51442 RRID: AB_2218174 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99990 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924