Iright
BRAND / VENDOR: Proteintech

Proteintech, 10128-2-AP, LRRC1 Polyclonal antibody

CATALOG NUMBER: 10128-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRRC1 (10128-2-AP) by Proteintech is a Polyclonal antibody targeting LRRC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10128-2-AP targets LRRC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LRRC1 consists of 524 amino acids including 16 leucine-rich repeats and a LAP-specific domain. It has been shown to be highly expressed in several human cancers and can participate in the malignant process of cancer cells, such as hepatocellular carcinoma, breast cancer and non-small cell lung cancer. (PMID: 36370237, PMID: 37505155) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0175 Product name: Recombinant human LRRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-266 aa of BC003193 Sequence: SIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLK Predict reactive species Full Name: leucine rich repeat containing 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC003193 Gene Symbol: LRRC1 Gene ID (NCBI): 55227 RRID: AB_2137458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924