Iright
BRAND / VENDOR: Proteintech

Proteintech, 10162-1-AP, C17orf81 Polyclonal antibody

CATALOG NUMBER: 10162-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C17orf81 (10162-1-AP) by Proteintech is a Polyclonal antibody targeting C17orf81 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10162-1-AP targets C17orf81 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, HEK-293 cells, K-562 cells Positive IHC detected in: mouse heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ELP5, also named as C17orf81, DERP6 and S-phase 2 protein, acts as subunit of the RNA polymerase II elongator complex. It's involved in TP53-mediated transcriptional regulation. ELP5 has some isoforms with MW 20 kDa, 30 kDa and 34-37 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0194 Product name: Recombinant human C17orf81 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC002762 Sequence: MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQASAHILCRRPRQR Predict reactive species Full Name: chromosome 17 open reading frame 81 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 37 and 45 kDa GenBank Accession Number: BC002762 Gene Symbol: C17orf81 Gene ID (NCBI): 23587 RRID: AB_2274975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TE02 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924