Iright
BRAND / VENDOR: Proteintech

Proteintech, 10167-1-AP, SERTAD1 Polyclonal antibody

CATALOG NUMBER: 10167-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SERTAD1 (10167-1-AP) by Proteintech is a Polyclonal antibody targeting SERTAD1 in IHC, ELISA applications with reactivity to human, mouse samples 10167-1-AP targets SERTAD1 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse heart tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SERTA domain containing 1 (SERTAD1, synonyms: SEI1, TRIP-Br1) protein is a cyclin-dependent kinase 4 (cdk4)-binding protein and acts as a growth factor sensor and facilitates the formation and activation of cyclin D-CDK complexes in the face of inhibitory levels of INK4 proteins, therefore, antagonizes the activity of p16(INK4a) tumor suppressor. SERTAD1 also suppresses CREB-mediated transcription and regulates cell cycle progression through sequential effects on the transcriptional activity of E2F-responsive promoters during G(1) and S phases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0180 Product name: Recombinant human SERTAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC002670 Sequence: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPG Predict reactive species Full Name: SERTA domain containing 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC002670 Gene Symbol: SERTAD1 Gene ID (NCBI): 29950 RRID: AB_2285697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924