Proteintech, 10183-1-AP, DIDO1 Polyclonal antibody

Size: 20ul / 150ul The DIDO1 (10183-1-AP) by Proteintech is a Polyclonal antibody targeting DIDO1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10183-1-AP targets DIDO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DIDO1, also termed DATF-1, C20orf158, DATF1, KIAA0333 and DIO-1, is a putative transcription factor, weakly pro-apoptotic when overexpressed. It is a tumor suppressor. In mice, DIDO1 is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. The human DIDO1 is similar to the mouse gene and therefore is thought to be involved in apoptosis. DIDO1 has multiple isoforms with molecular weights of 243 kd, 129 kd, 59 kd, and 61 kd. DIDO1 undergoes various modifications, including phosphorylation and ubiquitination, resulting in a mainstream molecular weight of 300 kd. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0237 Product name: Recombinant human DIDO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-544 aa of BC000770 Sequence: ADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKCSGKYLYSLHPSLIA Predict reactive species Full Name: death inducer-obliterator 1 Calculated Molecular Weight: 244 kDa Observed Molecular Weight: 300-350 kDa GenBank Accession Number: BC000770 Gene Symbol: DIDO1 Gene ID (NCBI): 11083 RRID: AB_2277375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.