Proteintech, 10196-1-AP, RBM14 Polyclonal antibody

Size: 20ul / 150ul The RBM14 (10196-1-AP) by Proteintech is a Polyclonal antibody targeting RBM14 in WB, ELISA applications with reactivity to human samples 10196-1-AP targets RBM14 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RBM14 is a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0254 Product name: Recombinant human RBM14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 465-666 aa of BC000488 Sequence: PVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQ Predict reactive species Full Name: RNA binding motif protein 14 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC000488 Gene Symbol: RBM14 Gene ID (NCBI): 10432 RRID: AB_2175748 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.