Iright
BRAND / VENDOR: Proteintech

Proteintech, 10204-2-AP, DUSP11 Polyclonal antibody

CATALOG NUMBER: 10204-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DUSP11 (10204-2-AP) by Proteintech is a Polyclonal antibody targeting DUSP11 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 10204-2-AP targets DUSP11 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, K-562 cells Positive IP detected in: K-562 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:700-1:2800 Background Information DUSP11, also known as PIR1, is a unique member of atypical DUSPs which could bind directly to RNA and possess RNA 5'-triphosphatase and diphosphatase activities. DUSP11 converts the 5' triphosphate of microRNA precursors to a 5' monophosphate, and regulates cellular noncoding RNAs levels. In addition to a catalysis towards RNA, more evidence showed that DUSP11 could also dephosphorylate proteins. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0276 Product name: Recombinant human DUSP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC000346 Sequence: MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICIYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGP Predict reactive species Full Name: dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC000346 Gene Symbol: DUSP11 Gene ID (NCBI): 8446 RRID: AB_2277484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75319 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924