Iright
BRAND / VENDOR: Proteintech

Proteintech, 10209-2-AP, CIRBP Polyclonal antibody

CATALOG NUMBER: 10209-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CIRBP (10209-2-AP) by Proteintech is a Polyclonal antibody targeting CIRBP in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10209-2-AP targets CIRBP in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells, A549 cells, HEK-293 cells, HepG2 cells, PC-12 cells, PC-13 cells, mouse testis tissue, rat testis tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human pancreas cancer tissue, human breast cancer tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells, HEK-293 cells, HepG2 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CIRBP, also named as A18HNRNP and CIRP, is a cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival[PMID: 19158277]. CIRBP is also involved in cap-independent translation upon moderate cold-shock. It acts as a translational activator. CIRBP is a suppressive rather stimulatory effect on proliferation[PMID: 19777567]. CIRBP can translocate from nucleus to cytoplasm under stresses such as UV irradation or heat shock. Suppression of CIRBP increased the apoptotic cell population of neural stem cells at moderate low temperature[PMID: 20735994]. This antibody (Catalog# 10209-2-AP) is a rabbit polyclonal antibody raised against the full-length CIRBP of human origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, squirrel Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0280 Product name: Recombinant human CIRBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC000403 Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE Predict reactive species Full Name: cold inducible RNA binding protein Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC000403 Gene Symbol: CIRBP Gene ID (NCBI): 1153 RRID: AB_2080263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14011 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924