Iright
BRAND / VENDOR: Proteintech

Proteintech, 10219-1-AP, EIF3D Polyclonal antibody

CATALOG NUMBER: 10219-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF3D (10219-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3D in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, yeast samples 10219-1-AP targets EIF3D in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, yeast samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, HepG2 cells, human brain tissue, L02 cells, HEK-293 cells, Jurkat cells Positive IP detected in: A549 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, Ethacrynic acid treated HepG2 cells, transfected cells, N/A, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine. Specification Tested Reactivity: human, mouse, yeast Cited Reactivity: human, mouse, rat, rabbit, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0268 Product name: Recombinant human EIF3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-531 aa of BC000328 Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit D Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC000328 Gene Symbol: EIF3D Gene ID (NCBI): 8664 RRID: AB_2096880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15371 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924