Proteintech, 10235-1-AP, MTCP1NB Polyclonal antibody

Size: 20ul / 150ul The MTCP1NB (10235-1-AP) by Proteintech is a Polyclonal antibody targeting MTCP1NB in IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10235-1-AP targets MTCP1NB in IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HEK-293T cells Positive IF/ICC detected in: U2OS cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MTCP1NB, also named as C6.1B, MTCP1, MTCP1B, is a member of the CMC4 protein family. MTCP1NB is 8 kDa protein that localizes to mitochondria. MTCP1NB was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations(NCBI). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0338 Product name: Recombinant human MTCP1NB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-68 aa of BC002600 Sequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK Predict reactive species Full Name: mature T-cell proliferation 1 neighbor Calculated Molecular Weight: 13 kDa, 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC002600 Gene Symbol: MTCP1NB Gene ID (NCBI): 100272147 RRID: AB_2189123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56277 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.