Iright
BRAND / VENDOR: Proteintech

Proteintech, 10243-1-AP, UBC13 Polyclonal antibody

CATALOG NUMBER: 10243-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBC13 (10243-1-AP) by Proteintech is a Polyclonal antibody targeting UBC13 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10243-1-AP targets UBC13 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, human heart tissue, Jurkat cells, mouse small intestine tissue Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2N is a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0292 Product name: Recombinant human UBE2N protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC000396 Sequence: MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYA Predict reactive species Full Name: ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC000396 Gene Symbol: UBC13/UBE2N Gene ID (NCBI): 7334 RRID: AB_2288109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924