Proteintech, 10250-1-AP, NME6 Polyclonal antibody

Size: 20ul / 150ul The NME6 (10250-1-AP) by Proteintech is a Polyclonal antibody targeting NME6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10250-1-AP targets NME6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, U2OS cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0315 Product name: Recombinant human NME6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC001808 Sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA Predict reactive species Full Name: non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC001808 Gene Symbol: NME6 Gene ID (NCBI): 10201 RRID: AB_2298600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75414 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.