Iright
BRAND / VENDOR: Proteintech

Proteintech, 10255-1-AP, HDAC3 Polyclonal antibody

CATALOG NUMBER: 10255-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HDAC3 (10255-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10255-1-AP targets HDAC3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, HAP1 cells, HL-60 cells, U-251 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, bEnd.3 cells, NIH/3T3 cells, C6 cells, mouse testis tissue, rat testis tissue Positive IP detected in: A431 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information What is the molecular weight of HDAC3? Is HDAC3 post-translationally modified?The molecular weight of HDAC3 is 49 kDa but HDAC3 can form homodimers and homotrimers in cells (PMID: 11779848). HDAC3 can be phosphorylated at S424 residue by protein kinase CK2, which regulates HDAC3 activity (PMID: 15805470).What is the subcellular localization of HDAC3?Unlike other class I HDACs, HDAC3 actively shuttles between the nucleus and cytoplasm (PMID: 11779848). Additionally, HDAC3 can be present at the plasma membrane, where it associates with c-Src (PMID: 16532030).What is the tissue expression pattern of HDAC3?Like other class I HDACs, HDAC3 is ubiquitously expressed (PMID: 9346952).What is the mechanism of HDAC3 in regulating gene expression?Unlike other histone deacetylates, it exists in a complex with two proteins - nuclear receptor co-repressor (N-CoR) and silencing mediator for retinoid and thyroid receptors (SMRT) - and therefore acts as a mediator of the repression function of unliganded nuclear hormone receptors (PMID: 10809664). N-CoR and SMRT play an active role in the recruitment of HDAC3 to binding sites as well as directly regulating HDAC3 activity. Additionally, HDAC3 targets growth-regulated genes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0396 Product name: Recombinant human HDAC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species Full Name: histone deacetylase 3 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC000614 Gene Symbol: HDAC3 Gene ID (NCBI): 8841 RRID: AB_2279733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924