Iright
BRAND / VENDOR: Proteintech

Proteintech, 10271-1-AP, FAF1 Polyclonal antibody

CATALOG NUMBER: 10271-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAF1 (10271-1-AP) by Proteintech is a Polyclonal antibody targeting FAF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10271-1-AP targets FAF1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, mouse testis tissue, mouse brain tissue, K-562 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information FAF1 was detected most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon, but not in the peripheral blood leukocytes.The N-terminal region (amino acid 1∼201) including the upstream ubiquitin homology domain of hFAF1 could bind with the death domain of Fas, which mediates programmed cell death, also called apoptosis, in a number of organ systems, notably the immune and nervous systems. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0407 Product name: Recombinant human FAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-489 aa of BC004970 Sequence: RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA Predict reactive species Full Name: Fas (TNFRSF6) associated factor 1 Calculated Molecular Weight: 650aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC004970 Gene Symbol: FAF1 Gene ID (NCBI): 11124 RRID: AB_2100774 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924