Proteintech, 10294-2-AP, CCM3/PDCD10 Polyclonal antibody

Size: 20ul / 150ul The CCM3/PDCD10 (10294-2-AP) by Proteintech is a Polyclonal antibody targeting CCM3/PDCD10 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10294-2-AP targets CCM3/PDCD10 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells, Raji cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development. Catalog#10294-2-AP is a rabbit polyclonal antibody raised against the full-length PDCD10 of human origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0348 Product name: Recombinant human PDCD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-101 aa of BC002506 Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ Predict reactive species Full Name: programmed cell death 10 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC002506 Gene Symbol: PDCD10 Gene ID (NCBI): 11235 RRID: AB_2162153 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.