Proteintech, 10306-1-AP, B23/NPM1 Polyclonal antibody

Size: 20ul / 150ul The B23/NPM1 (10306-1-AP) by Proteintech is a Polyclonal antibody targeting B23/NPM1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 10306-1-AP targets B23/NPM1 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, Jurkat cells, multi-cells, K-562 cells, HeLa cells, HEK-293 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis. NPM1 can interact with multiple proteins to form complexes, so the detected molecular weight may sometimes increase. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0286 Product name: Recombinant human B23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC002398 Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS Predict reactive species Full Name: nucleophosmin (nucleolar phosphoprotein B23, numatrin) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC002398 Gene Symbol: NPM1 Gene ID (NCBI): 4869 RRID: AB_2155163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.