Proteintech, 10310-1-AP, MPV17 Polyclonal antibody

Size: 20ul / 150ul The MPV17 (10310-1-AP) by Proteintech is a Polyclonal antibody targeting MPV17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10310-1-AP targets MPV17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MPV17, also termed as SYM1, encodes an inner mitochondrial membrane protein. It's potential candidate that may account for the mitochondrial (mt) DNA depletion syndromes (MDDS) characterized by a severe, tissue-specific decrease of mtDNA copy number and ultimate organ failure. It's a human ortholog of the mouse kidney disease gene Mpv17. Absence or malfunction of MPV17 causes oxidative phosphorylation (OXPHOS) failure and mtDNA depletion, not only in affected individuals but also in Mpv17-/- mice. MPV17 contribute to ROS homeostasis, but the downstream signaling is unknown yet. Catalog# 10310-1-AP is a rabbit polyclonal antibody raised against the full-length of human MPV17. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0312 Product name: Recombinant human MPV17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC001115 Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHR Predict reactive species Full Name: MpV17 mitochondrial inner membrane protein Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC001115 Gene Symbol: MPV17 Gene ID (NCBI): 4358 RRID: AB_2144642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P39210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.