Iright
BRAND / VENDOR: Proteintech

Proteintech, 10313-1-AP, CNOT2 Polyclonal antibody

CATALOG NUMBER: 10313-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CNOT2 (10313-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 10313-1-AP targets CNOT2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The Ccr4-Not complex is evolutionarily conserved and controls gene expression both at the level of transcription initiation and of mRNA degradation. And this complex can regulate pol II transcription. Promoter targeting of CCR4-NOT transcription complex subunit 2 (CNOT2) results in strong repression of pol II transcription. CNOT2-mediated repression is sensitive to the HDAC (histone deacetylase) inhibitor, TSA (trichostatin A). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0347 Product name: Recombinant human CNOT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-540 aa of BC002597 Sequence: QVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 2 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC002597 Gene Symbol: CNOT2 Gene ID (NCBI): 4848 RRID: AB_2245072 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924