Proteintech, 10327-1-AP, RAMP1 Polyclonal antibody

Size: 20ul / 150ul The RAMP1 (10327-1-AP) by Proteintech is a Polyclonal antibody targeting RAMP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 10327-1-AP targets RAMP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, H9C2 cells, human heart tissue, mouse stomach tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information RAMP1 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region, and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. RAMP1 can form a homodimer, which migrates at 30-37 kDa on SDS-PAGE. (PMID: 9620797; 16188935; 12051717;PMID: 18384073) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0402 Product name: Recombinant human RAMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC000548 Sequence: MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV Predict reactive species Full Name: receptor (G protein-coupled) activity modifying protein 1 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 14 kDa, 33-35 kDa GenBank Accession Number: BC000548 Gene Symbol: RAMP1 Gene ID (NCBI): 10267 RRID: AB_2269270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60894 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.