Iright
BRAND / VENDOR: Proteintech

Proteintech, 10333-1-AP, CHRNA3 Polyclonal antibody

CATALOG NUMBER: 10333-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul CHRNA3 Polyclonal Antibody for WB, IHC, ELISA 10333-1-AP targets CHRNA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse brain tissue, HepG2 cells, mouse thymus tissue, HEK-293 cells Positive IHC detected in: mouse brain tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CHRNA3, also named as NACHRA3, LNCR2 and PAOD2, is neuronal type nAChR subunits. It is a member of the nicotinic acetylcholine receptor family, which plays an important role in calcium regulation, neuronal development, and cognitive functions. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0272 Product name: Recombinant human CHRNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-238 aa of BC000513 Sequence: EAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIR Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 3 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000513 Gene Symbol: CHRNA3 Gene ID (NCBI): 1136 RRID: AB_2080511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924