Proteintech, 10335-1-AP, PSMG1 Polyclonal antibody

Size: 20ul / 150ul The PSMG1 (10335-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10335-1-AP targets PSMG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, Jurkat cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0303 Product name: Recombinant human PSMG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-249 aa of BC003619 Sequence: VWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEA Predict reactive species Full Name: proteasome (prosome, macropain) assembly chaperone 1 Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC003619 Gene Symbol: PSMG1 Gene ID (NCBI): 8624 RRID: AB_2877733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95456 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.