Iright
BRAND / VENDOR: Proteintech

Proteintech, 10344-1-AP, UBE3A Polyclonal antibody

CATALOG NUMBER: 10344-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBE3A (10344-1-AP) by Proteintech is a Polyclonal antibody targeting UBE3A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10344-1-AP targets UBE3A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse brain tissue, mouse lung tissue, Jurkat cells, NIH/3T3 cells, C6 cells Positive IP detected in: K-562 cells Positive IHC detected in: human thyroid cancer tissue, human kidney tissue, mouse lung tissue, rat liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information UBE3A(Ubiquitin-protein ligase E3A) is also named as E6AP, EPVE6AP, HPVE6A and belongs to the E3 ubiquitin protein ligase family. It functions as both an E3 ligase in the ubiquitin proteasome pathway and as a transcriptional coactivator. It is also initially identified as a cellular protein that mediates in vitro association of the human papillomavirus E6 protein with p53, leading to the ubiquitin-dependent degradation of p53(PMID:1661671). Defects in UBE3A are a cause of Angelman syndrome (AS)(PMID:10508479). It has 3 isoforms with MW of 97-101 kDa produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0346 Product name: Recombinant human UBE3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-215 aa of BC002582 Sequence: GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS Predict reactive species Full Name: ubiquitin protein ligase E3A Calculated Molecular Weight: 852 aa, 98 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC002582 Gene Symbol: UBE3A Gene ID (NCBI): 7337 RRID: AB_2211801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924