Iright
BRAND / VENDOR: Proteintech

Proteintech, 10347-1-AP, RAB4A Polyclonal antibody

CATALOG NUMBER: 10347-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB4A (10347-1-AP) by Proteintech is a Polyclonal antibody targeting RAB4A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10347-1-AP targets RAB4A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse brain tissue, rat brain tissue, HeLa cells, Neuro-2a cells, PC-12 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The human RAB genes share structural and biochemical properties with the Ras gene superfamily, and RAB4 (synonym: RAB4A) is a small GTPase belonging to this Ras superfamily. Accumulating data suggests an important role for RAB proteins either in endocytosis or in biosynthetic protein transport. The transport of newly synthesized proteins from endoplasmic reticulum to the Golgi complex and to secretory vesicles involves the movement of carrier vesicles, a process that appears to involve RAB protein function. RAB4 may also function as regulator along the receptor recycling pathway. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0357 Product name: Recombinant human RAB4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC002438 Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Predict reactive species Full Name: RAB4A, member RAS oncogene family Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC002438 Gene Symbol: RAB4A Gene ID (NCBI): 5867 RRID: AB_2177544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20338 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924