Proteintech, 10354-1-AP, GRWD1 Polyclonal antibody

Size: 20ul / 150ul The GRWD1 (10354-1-AP) by Proteintech is a Polyclonal antibody targeting GRWD1 in WB, IP, ELISA applications with reactivity to human samples 10354-1-AP targets GRWD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells, SKOV-3 cells Positive IP detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information WD-repeat proteins are a class of functionally divergent molecules that cooperate with other proteins to regulate cellular processes. WD-repeat proteins have been implicated in a variety of cellular functions that are mostly regulatory in nature, including cytoskeleton organization, vesicular fusion, pre-mRNA splicing, and cell cycle regulation. WD-repeat-containing protein designated glutamate-rich WD repeat (GRWD1) is a component of the 50S and 80S preribosomal complexes and plays a role in ribosome biogenesis and during myeloid differentiation its levels are regulated. (PMID:15885502) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0367 Product name: Recombinant human GRWD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-236 aa of BC002440 Sequence: AESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTG Predict reactive species Full Name: glutamate-rich WD repeat containing 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC002440 Gene Symbol: GRWD1 Gene ID (NCBI): 83743 RRID: AB_2114642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQ67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.