Iright
BRAND / VENDOR: Proteintech

Proteintech, 10369-1-AP, ErbB3/HER3 Polyclonal antibody

CATALOG NUMBER: 10369-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERBB3 (10369-1-AP) by Proteintech is a Polyclonal antibody targeting ERBB3 in IHC, ELISA applications with reactivity to human samples 10369-1-AP targets ERBB3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information V-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (ErbB-3, HER3) is a member of the EGF receptor tyrosine kinase family including EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3), and ErbB-4 (HER4) that are frequently overexpressed in a variety of carcinomas. These family members form either homodimers or heterodimers upon ligand binding to mediate cell growth. ErbB-3 binds and is activated by neuregulins and NTAK. It forms a heterodimer with each of the other ErbB receptors. ErbB-3 is predominantly expressed in epithelial tissues and brain, and is overexpressed in a subset of human mammary tumors. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0215 Product name: Recombinant human ERBB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-331 aa of BC002706 Sequence: LVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF Predict reactive species Full Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) Calculated Molecular Weight: 148 kDa GenBank Accession Number: BC002706 Gene Symbol: ERBB3 Gene ID (NCBI): 2065 RRID: AB_2099548 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21860 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924