Product Description
Size: 20ul / 150ul
The SNRPD3 (10379-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD3 in WB, IHC, ELISA applications with reactivity to human samples
10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF7 cells, MCF-7 cells
Positive IHC detected in: human small intestine tissue, human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species
Full Name: small nuclear ribonucleoprotein D3 polypeptide 18kDa
Calculated Molecular Weight: 18 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC000457
Gene Symbol: SNRPD3
Gene ID (NCBI): 6634
RRID: AB_2286308
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P62318
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924