Proteintech, 10381-1-AP, TTK Polyclonal antibody

Size: 20ul / 150ul The TTK (10381-1-AP) by Proteintech is a Polyclonal antibody targeting TTK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 10381-1-AP targets TTK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells, MCF-7 cells, HeLa cells Positive IP detected in: DU 145 cells Positive IHC detected in: human breast cancer tissue, human kidney tissue, human liver cancer tissue, human testis tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Mps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and/or spindle pole bodies/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0405 Product name: Recombinant human TTK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 536-789 aa of BC000633 Sequence: SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP Predict reactive species Full Name: TTK protein kinase Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 96-97 kDa GenBank Accession Number: BC000633 Gene Symbol: TTK Gene ID (NCBI): 7272 RRID: AB_2211979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.