Proteintech, 10388-1-AP, DNAL4 Polyclonal antibody

Size: 20ul / 150ul The DNAL4 (10388-1-AP) by Proteintech is a Polyclonal antibody targeting DNAL4 in WB, ELISA applications with reactivity to human, mouse samples 10388-1-AP targets DNAL4 in WB, ELISA, IF applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0587 Product name: Recombinant human DNAL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC002968 Sequence: MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS Predict reactive species Full Name: dynein, axonemal, light chain 4 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC002968 Gene Symbol: DNAL4 Gene ID (NCBI): 10126 RRID: AB_2230810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96015 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.