Proteintech, 10389-1-AP, ID3 Polyclonal antibody

Size: 20ul / 150ul The ID3 (10389-1-AP) by Proteintech is a Polyclonal antibody targeting ID3 in WB, ELISA applications with reactivity to human, mouse, rat samples 10389-1-AP targets ID3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, mink Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0588 Product name: Recombinant human ID3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003107 Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH Predict reactive species Full Name: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein Calculated Molecular Weight: 119 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC003107 Gene Symbol: ID3 Gene ID (NCBI): 3399 RRID: AB_2248830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02535 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.